PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02117.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 336aa    MW: 37051.1 Da    PI: 6.1321
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02117.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.76.9e-10147196554
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                              kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l   + 
  Rsa1.0_02117.1_g00006.1 147 KRAKRILANRQSAARSKERKARYIQELERKVQSLQTEATTLSAQLTLFQR 196
                              9****************************************998876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.3E-16143207IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.909145208IPR004827Basic-leucine zipper domain
PfamPF001703.3E-8147195IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.83E-10147198No hitNo description
Gene3DG3DSA:1.20.5.1704.3E-10147201No hitNo description
CDDcd147031.28E-22148197No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MDKSDPQQPK PAADPHPNPN ADPTPPSSFH RRSRSDDMSM FMFMDPLSSG GPPPSSDDLP  60
SDDDLFSSFI DVDSLSSNPH PAIAFPNHAS SNSVVVSGAV PSSSSRPRHR HSNSVDAGCA  120
MYANEIMDAK KAMPPEKLSE LWNIDPKRAK RILANRQSAA RSKERKARYI QELERKVQSL  180
QTEATTLSAQ LTLFQRDTNG LANENTELKM RLQAMEQQAH LRNALNEALR KELERMKIET  240
GEISGNSDSF DMGMQQVQYS PSTFMAIPPY HHGQDMQQMH GFNPSHPMEA MSNSQSVSEF  300
LQNGRMQGLE ISSNNSSSLV KSEGPSLSAS ESSSAY
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00129DAPTransfer from AT1G06850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013657521.11e-173PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P42e-82RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A078FME01e-173A0A078FME0_BRANA; BnaA08g28740D protein
STRINGBra031541.1-P1e-172(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135551727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06850.11e-123basic leucine-zipper 52